Gene Rv1954A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical protein |
| Comments | Rv1954A, len: 100 aa. Hypothetical unknown protein. |
| Functional category | Unknown |
| Operon | Rv1954A, Rv1955, Rv1956, and Rv1957 are co-transcribed, by RT-PCR (See Smollett et al., 2009). |
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2201277 | 2201579 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1954A|Rv1954A
MARGRVVCIGDAGCDCTPGVFRATAGGMPVLVVIESGTGGDQMARKATSPGKPAPTSGQYRPVGGGNEVTVPKGHRLPPSPKPGQKWVNVDPTKNKSGRG
Bibliography
- Smollett KL et al. [2009]. Experimental determination of translational start sites resolves uncertainties in genomic open reading frame predictions - application to Mycobacterium tuberculosis. Operon Sequence
- Fivian-Hughes AS et al. [2010]. Analyzing the regulatory role of the HigA antitoxin within Mycobacterium tuberculosis. Regulon
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
