Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in transcriptional mechanism.
ProductPossible antitoxin HigA
CommentsRv1956, (MTCY09F9.08c), len: 149 aa. Possible higA, antitoxin, part of toxin-antitoxin (TA) operon with Rv1955 (See Pandey and Gerdes, 2005; Gupta, 2009). Possible transcriptional regulatory protein, contains probable helix-turn-helix motif at aa 52-73 (+4.78 SD). Upon expression in E.coli Rv1956 has been shown to function as a toxin inhibiting cell growth and colony formation that is neutralized by coexpression with Rv1955 (PubMed: 19016878); It is not clear if these conflicting results are due to expression in a heterologous system. The gene names higA and higB have been assigned to both Rv1955 and Rv1956; we have chosen to call Rv1956 higA after consulting the authors.
Functional category-
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below).
OperonRv1954A, Rv1955, Rv1956, and Rv1957 are co-transcribed, by RT-PCR (See Smollett et al., 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Growth of M. tuberculosis H37Rv Rv1955-Rv1957 mutant (gene replacement) is comparable to wild-type; in-frame deletion of only Rv1956 was not possible; the Rv1955-Rv1957 mutant could be complemented with plasmid containing all three genes, but no colonies resulted when the plasmid lacked Rv1956 (See Fivian-Hughes and Davis, 2010).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22021382202587+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1956|higA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLSTLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
      
Bibliography