Gene Rv1965
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical integral membrane protein YrbE3B |
| Comments | Rv1965, (MTV051.03), len: 271 aa. YrbE4B, hypothetical unknown integral membrane protein, part of mce3 operon and member of YrbE family (see citations below), highly similar to Mycobacterium tuberculosis proteins O07413|Rv0168|MTCI28.08|yrbE1B (289 aa), FASTA scores: opt: 937, E(): 0, (54.3% identity in 254 aa overlap); O07790|Rv0588|MTCY19H5.34|yrbE2B (295 aa); etc. Also highly similar to conserved hypothetical integral membrane proteins of the yrbEB type, e.g. AAD24545.1|AF116213|YrbE1B from Mycobacterium leprae (106 aa); P45392|YRBE_ECOLI hypothetical 27.9 kDa protein from Escherichia coli (260 aa), FASTA scores: opt: 218, E(): 1.2e-07, (24.1% identity in 245 aa overlap); etc. The transcription of this CDS seems negatively regulated by the product of Rv1963c|mce3R (see Santangelo et al., 2002). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2208507 | 2209322 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1965|yrbE3B
MTAAKALVSEWNRMGSQMRFFVGTLAGIPDALMHYRGELLRVIAQMGLGTGVLAVIGGTVAIVGFLAMTTGAIVAVQGYNQFASVGVEALTGFASAFFNTREIQPGTVMVALAATVGAGTTAALGAMRINEEIDALEVIGIRSISYLASTRVLAGVVVAVPLFCVGLMTAYLAARVGTTAIYGQGSGVYDHYFNTFLRPTDVLWSSVEVVVVALMIMLVCTYYGYAAHGGPAGVGEAVGRAVRASMVVASIAILVMTLAIYGQSPNFHLAT
Bibliography
- Cole ST et al. [1998]. Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Sequence Secondary
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Santangelo MP et al. [2002]. Negative transcriptional regulation of the mce3 operon in Mycobacterium tuberculosis. Product Function Regulation
- de la Paz Santangelo M et al. [2009]. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Regulon
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
