Gene Rv1972
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved Mce associated membrane protein |
| Comments | Rv1972, (MTV051.10), len: 191 aa. Probable conserved Mce-associated membrane protein. Probably part of mce3 operon. Similar to several Mycobacterium tuberculosis proteins e.g. Rv1363c|Z75555|MTCY02B10.27C (261 aa), FASTA scores: opt: 342, E(): 1.2e-15, (31.8% identity in 195 aa overlap); Rv1362c, Rv0177 (near Mce operon 1), etc. Has hydrophobic stretch at aa 20-40. |
| Functional category | Cell wall and cell processes |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2216592 | 2217167 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1972|Rv1972
MSVAVDSDAEDDAVSEIAEAAGVSPAPAKPSMSAPRRMLLFGLVVVVALAVLLCCWGFRVQRARHAQDQRGHFLQAARQCALNLTTIDWRNAEADVRRILDGATGEFYNDFAQRSQPFVEVLRHAKASTVGTITEAGLQTQTADTAQALVAVSVQTSNAGEADPVPRAWRMRITVQRVGDRVKVSDVGFVP
Bibliography
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
