Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein
CommentsRv1974, (MTV051.12), len: 125 aa. Probable conserved membrane protein, weakly similar to other Mycobacterium tuberculosis proteins e.g. Rv1271c|Z77137|MTCY50.11 (113 aa), FASTA scores: opt: 98, E(): 1.4, (24.5% identity in 110 aa overlap); Rv1804c; Rv1690. Has possible signal peptide or transmembrane stretch from aa 12-30. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22176592218036+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1974|Rv1974
VQRQSLMPQQTLAAGVFVGALLCGVVTAAVPPHARADVVAYLVNVTVRPGYNFANADAALSYGHGLCEKVSRGRPYAQIIADVKADFDTRDQYQASYLLSQAVNELCPALIWQLRNSAVDNRRSG