Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1978, (MTV051.16), len: 282 aa. Conserved protein, similar to several hypothetical proteins and methyltransferases e.g. X86780|SHGCPIR.15 methyltransferase from S. hygroscopicus (211 aa), FASTA scores: opt: 151, E(): 0.0072, (30.6% identity in 121 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsThe product of this CDS corresponds to spot 4_120 identified by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (See Mattow et al., 2001). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22209082221756+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1978|Rv1978
MGEANIREQAIATMPRGGPDASWLDRRFQTDALEYLDRDDVPDEVKQKIIGVLDRVGTLTNLHEKYARIALKLVSDIPNPRILELGAGHGKLSAKILELHPTATVTISDLDPTSVANIAAGELGTHPRARTQVIDATAIDGHDHSYDLAVFALAFHHLPPTVACKAIAEATRVGKRFLIIDLKRQKPLSFTLSSVLLLPLHLLLLPWSSMRSSMHDGFISALRAYSPSALQTLARAADPGMQVEILPAPTRLFPPSLAVVFSRSSSAPTESSECSADRQPGE
      
Bibliography