Gene Rv1991A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Antitoxin MazE6 |
| Comments | Rv1991A, len: 82 aa. MazE6, antitoxin, part of toxin-antitoxin (TA) operon with Rv1991c. Similar to ChpI of L. interrogans, FASTA scores: opt: 134, E(): 0.024, 29.762% identity (65.476% similar) in 84 aa overlap. Note that Pandey and Gerdes, 2005 predicts a different N-terminus, adding 10 amino acids. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2234643 | 2234891 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1991A|mazE6
MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQIDRALESIHGTDEAEALAVANAYRVLETMDDEW
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Zhu L et al. [2006]. Characterization of mRNA interferases from Mycobacterium tuberculosis. Function Product
- Carroll P et al. [2007]. Expression of Mycobacterium tuberculosis Rv1991c using an arabinose-inducible promoter demonstrates its role as a toxin. Function Product
- Zhao L et al. [2008]. Biochemical characterization of a chromosomal toxin-antitoxin system in Mycobacterium tuberculosis. Function Product
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant