Gene Mb2014A
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | Antitoxin MazE6 |
Comments | Mb2014A, len: 82 aa. Equivalent to Rv1991A len: 82 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 82 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). MazE6, antitoxin, part of toxin-antitoxin (TA) operon with Rv1991c. Similar to ChpI of L. interrogans, FASTA scores: opt: 134, E(): 0.024,29.762% identity (65.476% similar) in 84 aa overlap. Note that Pandey and Gerdes, 2005 predicts a different N-terminus, adding 10 amino acids. |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2213559 | 2213807 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2014A|mazE6 MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQIDRALESIHGTDEAEALAVANAYRVLETMDDEW
Bibliography
No article yet recorded