Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSequence-specific mRNA cleavage
ProductToxin MazF6
CommentsRv1991c, (MTCY39.28), len: 114 aa. MazF6, toxin, part of toxin-antitoxin (TA) operon with Rv1991A. Some similarity to P13976|PEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622|YDCE protein from Bacillus subtilis (116 aa), FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryVirulence, detoxification, adaptation
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22343052234649-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1991c|mazF6
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
      
Bibliography