Gene Mb2014c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | toxin mazf6 |
| Comments | Mb2014c, -, len: 114 aa. Equivalent to Rv1991c,len: 114 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 114 aa overlap). Conserved hypothetical protein, showing some similarity to P13976|PEMK_ECOLI pemk protein (133 aa), FASTA scores: opt: 113, E(): 0.043, (29.2% identity in 113 aa overlap); and P96622|YDCE PROTEIN from Bacillus subtilis (116 aa),FASTA scores: opt: 227, E(): 6.9e-09, (37.4% identity in 115 aa overlap). Also similar to Mycobacterium tuberculosis Rv2801c, and Rv0659c. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2213221 | 2213565 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2014c|mazf6
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Bibliography
No article yet recorded