Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionRepresses transcription from the CMT operator-promoter. Repression is alleviated by CD(II).
ProductMetal sensor transcriptional regulator CmtR (ArsR-SmtB family)
CommentsRv1994c, (MTCY39.25), len: 118 aa. CmtR, transcriptional regulator (See Cavet et al., 2003). Similar to MERR_STRLI|P30346 probable mercury resistance operon repressor (125 aa), FASTA scores: opt: 199, E(): 3e-08, (36.3% identity in 102 aa overlap). Note that primer extension analysis revealed two transcriptional start sites (See Chauhan et al., 2009).
Functional categoryRegulatory proteins
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
OperonRv1994c, Rv1993c, and Rv1992c are co-transcribed in BCG (See Cavet et al., 2003) and M. tuberculosis H37Rv, by RT-PCR (See Chauhan et al., 2009).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22376282237984-
promoter22380012238036-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1994c|cmtR
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS