Gene Mb2017c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | metal sensor transcriptional regulator cmtr (arsr-smtb family) |
| Comments | Mb2017c, -, len: 118 aa. Equivalent to Rv1994c,len: 118 aa, from Mycobacterium tuberculosis strain H37Rv,(100.000% identity in 118 aa overlap). Probable transcription regulator, similar to MERR_STRLI|P30346 probable mercury resistance operon repressor (125 aa),FASTA scores: opt: 199, E(): 3e-08, (36.3% identity in 102 aa overlap). Contains probable helix-turn-helix motif at aa 36-57 (+3.78 SD). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2216544 | 2216900 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2017c|cmtr
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS
Bibliography
No article yet recorded