Gene Rv2008c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2008c, (MTCY39.09), len: 441 aa. Conserved hypothetical protein. Contains PS00017 ATP/GTP-binding site motif A, PS00501 Signal peptidases I serine active site. Also contains helix-turn-helix motif at aa 258-279. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2256617 | 2257942 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2008c|Rv2008c
MDEIESLIGLRPTPLTWPVVIAGDFLGVWDPPPSLPGAANHEISAPTARISCMLIERRDAAARLRRALHRAPVVLLTGPRQAGKTTLSRLVGKSAPECTFDAENPVDATRLADPMLALSGLSGLITIDEAQRIPDLFPVLRVLVDRPVMPARFLILGSASPDLVGLASESLAGRVELVELSGLTVRDVGSSAADRLWLRGGLPPSFTARSNEDSAAWRDGYITTFLERDLAQLGVRIPAATMRRAWTMLAHYHGQLFSGAELARSLDVAQTTARRYLDALTDALVVRQLTPWFANIGKRQRRSPKIYIRDTGLLHRLLGIDDRLALERNPKLGASWEGFVLEQLAALLAPNPLYYWRTQQDAELDLYVELSGRPYGFEIKRTSTPSISRSMRSALVDLQLARLAIVYPGEHRFPLSDTVVAVPADQILTTGSVDELLALLK
Bibliography
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
