Gene Rv2013
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of an insertion element. |
| Product | Transposase |
| Comments | Rv2013, (MTCY39.04c), len: 159 aa. Transposase, shows similarity to N-terminal part of transposase and insertion element hypothetical proteins. Length changed since first submission (no clear start apparent). |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2260665 | 2261144 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2013|Rv2013
VDTLLEAGITVVVISPNQLKNLRGRYGSAGNKDDRFDAFVLADTLRTDRSRLRPLLPDTPATATLRRTCRPRKDLVAHRVALANQLRAHLRVVFPGVVGLFADLDSPISLAFLTFLPRFDCQDRADWLSVKRLAGWLAAAGYCGRAPRPAHRCPARRHR
Bibliography
- Gordon SV et al. [1999]. New insertion sequences and a novel repeated sequence in the genome of Mycobacterium tuberculosis H37Rv. Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant