Gene Rv2036 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Conserved hypothetical protein | 
| Comments | Rv2036, (MTV018.23), len: 213 aa. Conserved hypothetical protein; similar to many. | 
| Functional category | Conserved hypotheticals | 
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see Betts et al., 2002). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 2282099 | 2282740 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2036|Rv2036
MIAADDDTEKSMMDMARAERAELAAFLTTLTLQQWETPSLCAGWSVKEVVAHMISYEDLGVFGLLKRFAKGRIVRANEVGVDEFAGLSPQELADYVGRHLQPRGLTAGFGGMIALVDGMIHHQDIRRPLGQPRTIPAQRLDRVLRLMPKNPRLRARPRIKGLRLRATDLDWTIGTGPEVTGPGEALLMAMAGRPAAVSDLSGPGKPTLAGRLG
      
    Bibliography
    - Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant