Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved hypothetical protein
CommentsRv2077A, len: 99 aa. Conserved hypothetical protein, similar to many.
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23342952334594-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2077A|Rv2077A
VGSNELQVVLGQLEVAASQSQGLGAQFAASATPPESGQPFQATTVAVSGINAAICCAAAEFATRTQATATGVAAAAAAYAHQEATAASEMAAVTQVTVV