Gene Rv2085
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2085, (MTCY49.24), len: 101 aa. Conserved hypothetical protein, similar to but shorter than many transposases but we can find no sequence errors to account for the frameshifts. Contains possible helix-turn-helix motif at aa 33 to 54,(+3.11 SD). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Insertion seqs and phages |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2343027 | 2343332 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2085|Rv2085
VSDMCDVVSFVGAAERVLRARFRPSPESGPPVHARRCGWSLGISAETLRRWAGQAEVDSGVVAGVSASRSGSVKTSELEQTIEILKVATSFFARKCDPRHR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence