Gene Rv2093c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in proteins export: required for correct localization of precursor proteins bearing signal peptides with the twin arginine conserved motif S/T-R-R-X-F-L-K. This sec-independent pathway is termed tat for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export. |
| Product | Sec-independent protein translocase transmembrane protein TatC |
| Comments | Rv2093c, (MT2154, MTCY49.33c), len: 308 aa. TatC, transmembrane protein, component of twin-arginine translocation protein export system (see citation below), similar to many. Belongs to the TatC family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene, determined by allelic exchange experiments (See Saint-Joanis et al., 2006). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2352103 | 2353029 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2093c|tatC
VRAAGLLKRLNPRNRRSRVNPDATMSLVDHLTELRTRLLISLAAILVTTIFGFVWYSHSIFGLDSLGEWLRHPYCALPQSARADISADGECRLLATAPFDQFMLRLKVGMAAGIVLACPVWFYQLWAFITPGLYQRERRFAVAFVIPAAVLFVAGAVLAYLVLSKALGFLLTVGSDVQVTALSGDRYFGFLLNLLVVFGVSFEFPLLIVMLNLAGLLTYERLKSWRRGLIFAMFVFAAIFTPGSDPFSMTALGAALTVLLELAIQIARVHDKRKAKREAAIPDDEASVIDPPSPVPAPSVIGSHDDVT
Bibliography
- Berks BC et al. [2000]. The Tat protein export pathway. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Saint-Joanis B et al. [2006]. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
