Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transfer of methyl group (from S-adenosyl-L-methionine to the substrate).
ProductRNA methyltransferase
CommentsRv2118c, (MTCY261.14c), len: 280 aa. S-adenosyl-l-methionine-dependent RNA methyltransferase (see citation below), similar to many. The larger catalytic C-terminal domain binds the cofactor S-adenosyl-l-methionine (AdoMet) and is involved in the transfer of methyl group from AdoMet to the substrate.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23774702378312-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
>Mycobacterium tuberculosis H37Rv|CDS|Rv2118c|2377470-2378312|-|Rv2118c|downstream:0|upstream:0
gtgtcagcaaccggcccattcagcatcggcgaacgtgttcagctcaccgacgctaaggggcgccgctacaccatgtcgctgactcccggtgccgaattccacactcatcgtggctcgatcgcccacgacgcggtgatcgggttggagcaaggcagcgtggtcaaatccagcaacggcgccctgttcctggtgctgcgcccgctgctggtcgactacgtcatgtcgatgccgcgcggcccgcaggtgatctatcccaaagatgcggcccagatcgtgcatgagggcgacatatttcccggcgcgcgggtgctggaggcaggagccggatccggtgctctgaccttgtctttgctgcgggcggttgggccggccggacaggtgatctcctacgaacagcgcgccgatcatgccgaacacgcccggcgcaatgtgagcggctgctacggccagccgccggacaactggcgactggtcgtcagcgacctcgccgactccgaactgcccgacggatccgttgatcgggccgtgctcgacatgctggcgccgtgggaggtgctcgacgcggtatcgcggctgctggtcgccggcggagtgctgatggtctacgtggccaccgtcactcagctgtcgaggatcgtggaggcactgcgggccaagcagtgctggaccgaaccgagagcctgggagacgctgcagcggggctggaacgtcgtagggttggcggttcggccgcagcattcgatgcgcgggcataccgcgttcctggtagcaacgcgccggttggcgccgggggctgtggctccggcgccgctaggtcgtaagcgcgagggacgcgacgggtag
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2118c|Rv2118c
VSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG