Gene Mb2142c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | rna methyltransferase |
| Comments | Mb2142c, -, len: 280 aa. Equivalent to Rv2118c,len: 280 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 280 aa overlap). Possible S-adenosyl-l-methionine-dependent RNA methyltransferase (EC 2.1.1.-) (see citation below); corresponds to Mycobacterium leprae B2126_C1_165, similar to hypothetical proteins from several organisms e.g. Y134_METJA Q57598 hypothetical protein mj0134 (282 aa), FASTA scores; opt: 256, E(): 1e-13, FASTA scores; 30.2% identity in 285 aa overlap. The larger catalytic C-terminal domain binds the cofactor S-adenosyl-l-methionine (AdoMet) and is involved in the transfer of methyl group from AdoMet to the substrate. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2357895 | 2358737 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2142c|Mb2142c
MSATGPFSIGERVQLTDAKGRRYTMSLTPGAEFHTHRGSIAHDAVIGLEQGSVVKSSNGALFLVLRPLLVDYVMSMPRGPQVIYPKDAAQIVHEGDIFPGARVLEAGAGSGALTLSLLRAVGPAGQVISYEQRADHAEHARRNVSGCYGQPPDNWRLVVSDLADSELPDGSVDRAVLDMLAPWEVLDAVSRLLVAGGVLMVYVATVTQLSRIVEALRAKQCWTEPRAWETLQRGWNVVGLAVRPQHSMRGHTAFLVATRRLAPGAVAPAPLGRKREGRDG
Bibliography
No article yet recorded