Gene Rv2141c (dapE2)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved protein |
| Comments | Rv2141c, (MTCY270.27), len: 448 aa. Conserved protein. Shows some similarity to conserved hypothetical proteins and to acetylornithine deacetylase and succinyl-diaminopimelate desuccinylase and contains ArgE/dapE/ACY1/CPG2/yscS family signature 1 (PS00758). FASTA best: CBPS_YEAST P27614 carboxypeptidases precursor (576 aa) opt: 234, E(): 4.3e-08; (24.3% identity in 412 aa overlap). Previously named dapE2. Conserved in M. tuberculosis, M. leprae, M. bovis and M. avium paratuberculosis; predicted to be essential for in vivo survival and pathogenicity (See Ribeiro-Guimaraes and Pessolani, 2007). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2400376 | 2401722 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2141c|Rv2141c
VTDETGASSDHSDDVAQVVSRLIRFDTTNSGEPGTTKGEAECARWVAEQLAEVGYQPEYVESGAPGRGNVFARLAGADSSRGALLIHGHLDVVPAEPAEWSVHPFSGAIEDGYVWGRGAVDMKDMVGMMIVVARHLRQAAIVPPRDLVFAFVADEEHGGKYGSHWLVDNRPDLFDGITEAIGEVGGFSLTVPRHDGGERRLYLIETAEKGIQWMRLTARGRAGHGSMVHDQNAVTAVCEAVARLGRHQFPLVCTDTVAQFLAVVGEETGLAFDLDSPDLAGTIDKLGPMARMLKAVLHDTANPTMLKAGYKANVVPATAEAVVDCRVLPGRRAAFEAEVDALIGPDVTREWVSDLPSYETTFDGDLVAAMNAAVLAVDPDGRTVPYMLSGGTDAKAFARLGIRCFGFSPLRLPPDLDFTSLFHGVDERVPIDGLRFGTEVLTHLLTHC
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Ribeiro-Guimarães ML et al. [2007]. Comparative genomics of mycobacterial proteases. Homology
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
