Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved protein
CommentsRv2166c, (MTCY270.02), len: 143 aa. Conserved protein; shows strong similarity to several hypothetical bacterial proteins such as YLLB_BACSU P55343. Is equivalent to Mycobacterium leprae hypothetical protein ML0905 (143 aa, 92% identity) MLCB268.11c >sp|O69561|YL66_MYCLE hypothetical 16.1 KDA protein ML0905 >gi|3080482|emb|CAA18677.1|(AL022602) >gi|13092975|emb|CAC31286.1|(AL583920). FASTA scores: ML0905|ML0905 conserved hypothetical protein (143 aa) opt: 873, E(): 3.1e-52; 92.254% identity in 142 aa overlap; YLLB_BACSU P55343 hypothetical 16.6 kDa protein (143 aa) opt: 340, E(): 3.6e-17; (35.0% identity in 143 aa overlap). Belongs to the YABB (E.coli), YLLB (B.subtilis), MG221 (M.genitalium) family
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS24294272429858-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2166c|Rv2166c
MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKSQDHSLAVYPRAAFEQLARRASKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLSKDCVVIGAVDYLEIWDAQAWQNYQQIHEENFSAASDEALGDIF