Gene Mb2190c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb2190c, -, len: 143 aa. Equivalent to Rv2166c,len: 143 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 143 aa overlap). Conserved hypothetical protein; shows strong similarity to several hypothetical bacterial proteins such as YLLB_BACSU P55343. Is equivalent to Mycobacterium leprae hypothetical protein ML0905 (143 aa, 92% identity) MLCB268.11c >sp|O69561|YL66_MYCLE HYPOTHETICAL 16.1 KDA PROTEIN ML0905 >gi|3080482|emb|CAA18677.1|(AL022602) >gi|13092975|emb|CAC31286.1|(AL583920). FASTA scores: ML0905|ML0905 conserved hypothetical protein (143 aa) opt: 873, E(): 3.1e-52; 92.254% identity in 142 aa overlap; YLLB_BACSU P55343 hypothetical 16.6 kd protein (143 aa) opt: 340, E(): 3.6e-17; (35.0% identity in 143 aa overlap). BELONGS TO THE YABB (E.COLI), YLLB (B.SUBTILIS),MG221 ( M.GENITALIUM) FAMILY |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2409819 | 2410250 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2190c|Mb2190c MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKSQDHSLAVYPRAAFEQLARRASKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLSKDCVVIGAVDYLEIWDAQAWQNYQQIHEENFSAASDEALGDIF
Bibliography
No article yet recorded