Gene Rv2189c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2189c, (MTV021.22c), len: 257 aa. Conserved hypothetical protein; some similarity to hypothetical protein SC6G10.07c (385 aa) from Streptomyces coelicolor A3(2). Smith-Waterman scores: pir||T35516 hypothetical protein SC6G10.07c - Streptomyces coelicolor >gi|4539203|emb|CAB39861.1| (AL049497) Expect = 2e-08; 30% identity in 245 aa overlap. |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2451247 | 2452020 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2189c|Rv2189c
VRDGPAAPAQVVAPADGFVALRVADDRTVRLLSLGGAATDRLLSRIAAGIDAAVDEVVAFWGTDWSHDIFVVAAGSDEQFHAAAGGGLASQWADIAAITVVDRVDPARRTVVGQRIVFAPGAAHMSPAALRIVLGHELFHYAARADTALDAPRWLAEGVADFVARPKTPPPADAVSVALSLPSDTDLDTPGPQRSLAYDRAWWFARFVAAAYGTAKLRELYLATCGVGHFDLATAAHDVLGIDAAGLLARWQRWLMG
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
