Gene Rv2234 (MPtpA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in signal transduction (via dephosphorylation). Can dephosphorylated in vitro the phosphotyrosine residue of myelin basic protein (MBP) at pH 7.0 [catalytic activity: protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate]. |
| Product | Phosphotyrosine protein phosphatase PtpA (protein-tyrosine-phosphatase) (PTPase) (LMW phosphatase) |
| Comments | Rv2234, (MTCY427.15), len: 163 aa. PtpA (alternate gene name: MPtpA), low molecular weight protein-tyrosine-phosphatase (see citations below), similar to other phosphotyrosine protein phosphatases e.g. P53433|PTPA_STRCO low molecular weight protein-tyrosine phosphatase from Streptomyces coelicolor (164 aa), FASTA scores: opt: 455, E(): 3.3e -25, (49.7% identity in 155 aa overlap); PA1S_HUMAN|P24667 red cell acid phosphatase 1, FASTA score: (37.7% identity in 138 aa overlap); etc. Contains a phosphatase catalytic site domain located in N-terminal part. Activity proven biochemically. Supposed a secreted protein. Substrate of PtkA|Rv2232. |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Growth of M. tuberculosis Erdman ptpA|Rv2234 mutant is comparable to wild-type in vitro and in C57BL/6 mice (See Grundner et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2507146 | 2507637 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2234|ptpA
VSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
Bibliography
- Koul A et al. [2000]. Cloning and characterization of secretory tyrosine phosphatases of Mycobacterium tuberculosis. Product Biochemistry Function
- Cowley SC et al. [2002]. Expression and localization of the Mycobacterium tuberculosis protein tyrosine phosphatase PtpA. Biochemistry Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Madhurantakam C et al. [2005]. Crystal structure of low-molecular-weight protein tyrosine phosphatase from Mycobacterium tuberculosis at 1.9-A resolution. Structure
- Castandet J et al. [2005]. Tyrosine phosphatase MptpA of Mycobacterium tuberculosis inhibits phagocytosis and increases actin polymerization in macrophages. Function
- Grundner C et al. [2008]. Protein tyrosine phosphatase PtpA is not required for Mycobacterium tuberculosis growth in mice. Mutant
- Bach H et al. [2009]. Mycobacterium tuberculosis PtkA is a novel protein tyrosine kinase whose substrate is PtpA. Biochemistry
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant