Gene Rv2250A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Electron acceptor |
| Product | Possible flavoprotein |
| Comments | Rv2250A, len: 139 aa. Conserved hypothetical protein, possibly flavoprotein. Similar to N-terminus of SCF91.28c|AL132973_28 possible flavoprotein from Streptomyces coelicolor (530 aa), FASTA scores: opt: 240, E(): 1.1e-07, (39.25% identity in 107 aa overlap). Possible frameshift between nt 2525723 to 2525727. The sequences of CDC 1551 and Mycobacterium bovis are missing a single G base. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2525402 | 2525821 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2250A|Rv2250A
MKWDAWGDPAAAKPLSDGVRSLLKQVVGLADSEQPELDPAQVQLRPSALSGADHDALARIVGTEYFRTADRDRLLHAGGKSTPDLLRRKDTGVQDAPDAVLLPGGPNGGGRRRRHLALLLRPRHCRGPVWWRHQRRWWA
Bibliography
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
