Gene Rv2261c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; thought to be involved in lipid metabolism. |
| Product | Conserved hypothetical protein |
| Comments | Rv2261c, (MTV022.11c), len: 140 aa. Conserved hypothetical protein, with function unknown but some similarity to C-terminal end of PCC6803 apolipoprotein N-acyltransferase from Synechocystis sp. Note that next ORF shows similarity to N-terminal part of P74055 apolipoprotein N-acyltransferase from Escherichia coli (519 aa), FASTA scores: opt: 142, E(): 0.007, (29.9% identity in 117 aa overlap), suggesting possible frameshift. Sequence of clones from two sources has been checked but no error found. |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2534042 | 2534464 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2261c|Rv2261c
LHIAPLISYEMTFSDLTRHAARLGAALLVYQSSTSTFQGSWAQPQLAAQPAVRAVEAGIPAVHASLSGDSSAFDTRGRRLAWCSAEFNGAIVVNVPLASNVTLYLRLGDWVPVTAFVVMGAGFAVFLRRSLARVSDCADK
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
