Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; thought to be involved in lipid metabolism.
ProductConserved hypothetical protein
CommentsRv2261c, (MTV022.11c), len: 140 aa. Conserved hypothetical protein, with function unknown but some similarity to C-terminal end of PCC6803 apolipoprotein N-acyltransferase from Synechocystis sp. Note that next ORF shows similarity to N-terminal part of P74055 apolipoprotein N-acyltransferase from Escherichia coli (519 aa), FASTA scores: opt: 142, E(): 0.007, (29.9% identity in 117 aa overlap), suggesting possible frameshift. Sequence of clones from two sources has been checked but no error found.
Functional categoryLipid metabolism
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25340422534464-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2261c|Rv2261c
LHIAPLISYEMTFSDLTRHAARLGAALLVYQSSTSTFQGSWAQPQLAAQPAVRAVEAGIPAVHASLSGDSSAFDTRGRRLAWCSAEFNGAIVVNVPLASNVTLYLRLGDWVPVTAFVVMGAGFAVFLRRSLARVSDCADK