Gene Rv2265
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved integral membrane protein |
| Comments | Rv2265, (MTCY339.45c), len: 409 aa. Possible conserved integral membrane protein, with some similarity to others e.g. M. thermoauto. sp|O26855|O26855 conserved protein (383 aa), FASTA score: opt: 898 z-score: 1023.5 E(): 0; 38.0% identity in 384 aa overlap; Q58713 hypothetical 44.1 kDa protein 1 317 (398 aa), FASTA scores, opt: 305 E(): 1.2e-11; 22.8% identity in 382 aa overlap; also KGTP_ECOLI P17448 alpha-ketoglutarate permease (432 aa), FASTA scores, opt: 156, E(): 0.006, (24.8% identity in 416 aa overlap) |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2538700 | 2539929 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2265|Rv2265
VGANGDVALSRIGATRPALSAWRFVTVFGVVGLLADVVYEGARSITGPLLASLGATGLVVGVVTGVGEAAALGLRLVSGPLADRSRRFWAWTIAGYTLTVVTVPLLGIAGALWVACALVIAERVGKAVRGPAKDTLLSHAASVTGRGRGFAVHEALDQVGAMIGPLTVAGMLAITGNAYAPALGVLTLPGGAALALLLWLQRRVPRPESYEDCPVVLGNPSAPRPWALPAQFWLYCGFTAITMLGFGTFGLLSFHMVSHGVLAAAMVPVVYAAAMAADALTALASGFSYDRYGAKTLAVLPILSILVVLFAFTDNVTMVVIGTLVWGAAVGIQESTLRGVVADLVASPRRASAYGVFAAGLGAATAGGGALIGWLYDISIGTLVVVVIALELMALVMMFAIRLPRVAPS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
