Gene Rv2277c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible glycerolphosphodiesterase |
| Comments | Rv2277c, (MTCY339.33), len: 301 aa. Possible glycerolphosphodiesterase, similar to e.g. UGPQ_ECOLI P10908 glycerophosphoryldiester phosphodiesterase (cytosolic) (247 aa), FASTA scores, opt: 149, E(): 0.0061, (27.2% identity in 195 aa overlap). Start of protein uncertain, encoded by neighbouring IS6110 as given, is intact in Mycobacterium tuberculosis CDC1551 |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2549124 | 2550029 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2277c|Rv2277c
MPGRFTVALVIALGGTCGVADALPLGQTDDPMIVAHRAGTRDFPENTVLAITNAVAAGVDGMWLTVQVSSDGVPVLYRPSDLATLTDGAGPVNSKTVQQLQQLNAGWNFTTPGVEGHPYRQRATPIPTLEQAIGATPPDMTLFLDLKQTPPQPLVSAVAQVLTRTGAAGRSIVYSTNADITAAASRQEGLQVAESRDVTRQRLFNMALNHHCDPQPDPGKWAGFELHRDVTVTEEFTLGSGISAVNAELWDEASVDCFRSQSGMKVMGFAVKTVDDYRLAHKIGLDAVLVDSPLAAQQWRH
Bibliography
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Tsolaki AG, Hirsh AE, DeRiemer K, Enciso JA, Wong MZ, Hannan M, Goguet de la Salmoniere YO, Aman K, Kato-Maeda M and Small PM [2004]. Functional and evolutionary genomics of Mycobacterium tuberculosis: insights from genomic deletions in 100 strains. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
