Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible glycerolphosphodiesterase
CommentsRv2277c, (MTCY339.33), len: 301 aa. Possible glycerolphosphodiesterase, similar to e.g. UGPQ_ECOLI P10908 glycerophosphoryldiester phosphodiesterase (cytosolic) (247 aa), FASTA scores, opt: 149, E(): 0.0061, (27.2% identity in 195 aa overlap). Start of protein uncertain, encoded by neighbouring IS6110 as given, is intact in Mycobacterium tuberculosis CDC1551
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25491242550029-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2277c|Rv2277c
MPGRFTVALVIALGGTCGVADALPLGQTDDPMIVAHRAGTRDFPENTVLAITNAVAAGVDGMWLTVQVSSDGVPVLYRPSDLATLTDGAGPVNSKTVQQLQQLNAGWNFTTPGVEGHPYRQRATPIPTLEQAIGATPPDMTLFLDLKQTPPQPLVSAVAQVLTRTGAAGRSIVYSTNADITAAASRQEGLQVAESRDVTRQRLFNMALNHHCDPQPDPGKWAGFELHRDVTVTEEFTLGSGISAVNAELWDEASVDCFRSQSGMKVMGFAVKTVDDYRLAHKIGLDAVLVDSPLAAQQWRH
      
Bibliography