Gene Mb2300c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible glycerolphosphodiesterase |
| Comments | Mb2300c, -, len: 299 aa. Equivalent to Rv2277c,len: 301 aa, from Mycobacterium tuberculosis strain H37Rv,(99.661% identity in 295 aa overlap). Possible glycerolphosphodiesterase, similar to e.g. UGPQ_ECOLI P10908 glycerophosphoryldiester phosphodiesterase (cytosolic) (247 aa), FASTA scores, opt: 149, E(): 0.0061,(27.2% identity in 195 aa overlap). Start of protein uncertain, encoded by neighbouring IS6110 as given, is intact in Mycobacterium tuberculosis CDC1551. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 1358 bp deletion containing an IS6110 sequence prior to the start of Mb2300c disrupts the 5' start of Rv2277c resulting in a slightly shorter product compared to the homolog in Mycobacterium tuberculosis strain H37Rv (299 aa versus 301 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2528078 | 2528977 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2300c|Mb2300c
MLGAVALVIALGGTCGVADALPLGQTDDPMIVAHRAGTRDFPENTVLAITNAVAAGVDGMWLTVQVSSDGVPVLYRPSDLATLTDGAGPVNSKTVQQLQQLNAGWNFTTPGVEGHPYRQRATPIPTLEQAIGATPPDMTLFLDPKQTPPQPLVSAVAQVLTRTGAAGRSIVYSTNADITAAASRQEGLQVAESRDVTRQRLFNMALNHHCDPQPDPGKWAGFELHRDVTVTEEFTLGSGISAVNAELWDEASVDCFRSQSGMKVMGFAVKTVDDYRLAHKIGLDAVLVDSPLAAQQWRH
Bibliography
No article yet recorded
