Gene Rv2303c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could be involved in antibiotic-resistance. |
| Product | Probable antibiotic-resistance protein |
| Comments | Rv2303c, (MTCY339.06, MT2360), len: 307 aa. Probable antibiotic-resistance protein, with some similarity to Q54229|G153373 macrotetrolide antibiotic-resistance protein (NONR) from Streptomyces griseus (347 aa) (see Plater and Robinson, 1992), FASTA scores: opt: 438, E(): 3.1e-21, (33.2% identity in 226 aa overlap); and other hypothetical proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 252, E(): 3.5e-09, (25.5% identity in 286 aa overlap); etc. Also similar to Mycobacterium tuberculosis Rv3510c|O53555|MTV023.17. Note that the protein Q9XDF3|NONC from Streptomyces griseus subsp. griseus (317 aa) is equivalent to Q54229|G153373|NONR however the N-terminal end is shorter (30 aa) owing to a changed start codon (see Walczak et al., 2000). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | - |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2574096 | 2575019 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2303c|Rv2303c
MTAPEPRVPVIDMWAPFVPSAEVIDDLREGFPVELLSYFEVFTKTTISAEQFGAYAESLRRTDDQILDSLDDAGITRSLITGFDERSTCGVTFVHNASVAAVAARYPDRFLPFAGADILAGDSAVDEFERWVVEHGFRGLSLRPFMIGRPASDPAYFPCYAKCVELGVPVSIHTSADWTRTRLSDLGHPRHIDDVACRFPELTILMSHGGYPWVLQACLIAWKHPNVYLELAAHRPKYFASPGAGWEPLMRFGQTTIRNKIVYGTGGFLINRPYLQLCDEMRALPVPREVLEDWLWRNATRVLRLDT
Bibliography
- Plater R et al. [1992]. Cloning and sequence of a gene encoding macrotetrolide antibiotic resistance from Streptomyces griseus. Homolog Sequence
- Walczak RJ et al. [2000]. Nonactin biosynthesis: the potential nonactin biosynthesis gene cluster contains type II polyketide synthase-like genes. Homolog Sequence
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant