Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould be involved in antibiotic-resistance.
ProductProbable antibiotic-resistance protein
CommentsRv2303c, (MTCY339.06, MT2360), len: 307 aa. Probable antibiotic-resistance protein, with some similarity to Q54229|G153373 macrotetrolide antibiotic-resistance protein (NONR) from Streptomyces griseus (347 aa) (see Plater and Robinson, 1992), FASTA scores: opt: 438, E(): 3.1e-21, (33.2% identity in 226 aa overlap); and other hypothetical proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 252, E(): 3.5e-09, (25.5% identity in 286 aa overlap); etc. Also similar to Mycobacterium tuberculosis Rv3510c|O53555|MTV023.17. Note that the protein Q9XDF3|NONC from Streptomyces griseus subsp. griseus (317 aa) is equivalent to Q54229|G153373|NONR however the N-terminal end is shorter (30 aa) owing to a changed start codon (see Walczak et al., 2000). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryVirulence, detoxification, adaptation
ProteomicsTranslational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25740962575019-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2303c|Rv2303c
MTAPEPRVPVIDMWAPFVPSAEVIDDLREGFPVELLSYFEVFTKTTISAEQFGAYAESLRRTDDQILDSLDDAGITRSLITGFDERSTCGVTFVHNASVAAVAARYPDRFLPFAGADILAGDSAVDEFERWVVEHGFRGLSLRPFMIGRPASDPAYFPCYAKCVELGVPVSIHTSADWTRTRLSDLGHPRHIDDVACRFPELTILMSHGGYPWVLQACLIAWKHPNVYLELAAHRPKYFASPGAGWEPLMRFGQTTIRNKIVYGTGGFLINRPYLQLCDEMRALPVPREVLEDWLWRNATRVLRLDT