Gene Mb2325c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE ANTIBIOTIC-RESISTANCE PROTEIN |
| Comments | Mb2325c, -, len: 307 aa. Equivalent to Rv2303c,len: 307 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 307 aa overlap). Probable antibiotic-resistance protein, with some similarity to Q54229|G153373 macrotetrolide antibiotic-resistance protein (NONR) from Streptomyces griseus (347 aa) (see the first citation below), FASTA scores: opt: 438, E(): 3.1e-21, (33.2% identity in 226 aa overlap); and other hypothetical proteins e.g. P95886 ORF C02006 from Sulfolobus solfataricus (269 aa), FASTA scores: opt: 252,E(): 3.5e-09, (25.5% identity in 286 aa overlap). Also similar to Mycobacterium tuberculosis Rv3510c|O53555|MTV023.17. Note that the protein Q9XDF3|NONC from Streptomyces griseus subsp. griseus (317 aa) is equivalent to Q54229|G153373|NONR however the N-terminal end is shorter (30 aa) owing to a changed start codon (see the second citation below). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2551691 | 2552614 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2325c|Mb2325c
MTAPEPRVPVIDMWAPFVPSAEVIDDLREGFPVELLSYFEVFTKTTISAEQFGAYAESLRRTDDQILDSLDDAGITRSLITGFDERSTCGVTFVHNASVAAVAARYPDRFLPFAGADILAGDSAVDEFERWVVEHGFRGLSLRPFMIGRPASDPAYFPCYAKCVELGVPVSIHTSADWTRTRLSDLGHPRHIDDVACRFPELTILMSHGGYPWVLQACLIAWKHPNVYLELAAHRPKYFASPGAGWEPLMRFGQTTIRNKIVYGTGGFLINRPYLQLCDEMRALPVPREVLEDWLWRNATRVLRLDT
Bibliography
No article yet recorded