Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductUnknown protein
CommentsRv2305, (MTCY339.04c), len: 429 aa. Unknown protein. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis; transcription repressed at low pH in vitro conditions, which may mimic an environmental signal encountered by phagocytosed bacteria (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS25758092577098+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2305|Rv2305
MTQTLRLTALDEMFITDDIDIVPSVQIEARVSGRFDLDRLAAALRAAVAKHALARARLGRASLTARTLYWEVPDRADHLAVEITDEPVGEVRSRFYARAPELHRSPVFAVAVVRETVGDRLLLNFHHAAFDGMGGLRLLLSLARAYAGEPDEVGGPPIEEARNLKGVAGSRDLFDVLIRARGLAKPAIDRKRTTRVAPDGGSPDGPRFVFAPLTIESDEMATAVARRPEGATVNDLAMAALALTILQWNRTHDVPAADSVSVNMPVNFRPTAWSTEVISNFASYLAIVLRVDEVTDLEKATAIVAGITGPLKQSGAAGWVVDLLEGGKVLPAMLKRQLQLLLPLVEDRFVESVCLSNLGRVDVPAFGGEAGDTTEVWFSPTAAMSVMPIGVGLVGFGGTLRAMFRGDGRTIGGEALGRFAALYRDTLLT
      
Bibliography