Gene Rv2306A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv2306A, len: 197 aa. Possible conserved membrane protein, similar to several hypothetical membrane proteins from Mycobacterium tuberculosis and Streptomyces coelicolor, e.g. Rv0625c|P96915|Y625_MYCTU hypothetical 25.2 KDA protein from Mycobacterium tuberculosis (246 aa), FASTA scores: opt: 410, E(): 2.7e-17, (53.25% identity in 139 aa overlap). First 140 aa show high similarity, this then decreases but continues in next ORF Rv2306B, suggesting a frameshift near nt 2577473. However the sequence has been checked and no error found. The sequence is identical in CDC1551 and Mycobacterium bovis. Replaces original Rv2306c on other strand. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2577108 | 2577701 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2306A|Rv2306A
MTDNECPADSRRRHVLRLALFAGILLGLFYLVAVARVIHVDGVRSAIVVATGPIAPLAYVVVSAALGALFVPGPILAAGSGVLFGPLLDTFVTLPAFSAGAQAGMTPRRCWVSIAPIASMHRSNGADCGRWSVSASSPASRMRWPRTPSGRSEFRCGRWSLGRSSGRRHGCSSTPRWARRSPTCRRRWFTRRSRCGA
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
