Gene Rv2306B
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved membrane protein |
| Comments | Rv2306B, len: 144 aa. Possible conserved membrane protein, similar to C-terminal part of several hypothetical membrane proteins from Mycobacterium tuberculosis and Streptomyces coelicolor e.g. P96915|Y625_MYCTU|RV0625c hypothetical 25.2 KDA protein from Mycobacterium tuberculosis (246 aa), FASTA scores: opt: 480, E(): 5e-24, (77.15% identity in 92 aa overlap). Could be a continuation of Rv2306A suggesting there may be a frameshift near nt 2577473. The C-terminal part is longer than Rv0625c and the 3'-end of gene overlaps Rv2307c, so maybe a further framehift. However, sequence has been checked and no error found. Also same sequence as strain CDC1551 and Mycobacterium bovis. Replaces original Rv2306c on other strand. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2577488 | 2577922 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2306B|Rv2306B
LWAVVGQRFVPGISDALASYTFGAFGVPLWQMVVGSFIGSAPRVFVYTALGASITNLSSPLVYSAIAVWCVTAIIGAFAARRWYRKWRARPRRRCGLAQLTTGSQQRHTSHRTPAGVVMPGSLSEHRRLRQEAPDRIEHHPPIE
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
