Gene Mb2329
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE CONSERVED MEMBRANE PROTEIN |
| Comments | Mb2329, -, len: 144 aa. Equivalent to Rv2306B, len: 144 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 144 aa overlap). Possible conserved membrane protein, similar to C-terminal part of several hypothetical membrane proteins from Mycobacterium tuberculosis and Streptomyces coelicolor e.g. P96915|Y625_MYCTU|RV0625c HYPOTHETICAL 25.2 KDA PROTEIN from Mycobacterium tuberculosis (246 aa), FASTA scores: opt: 480, E(): 5e-24, (77.15% identity in 92 aa overlap). Could be a continuation of Rv2306A suggesting there may be a frameshift near nt 2577473. The C-terminal part is longer than Rv0625c and the 3'-end of gene overlaps Rv2307c, so maybe a further framehift. However, sequence has been checked and no error found. Also same sequence as strain CDC1551 and Mycobacterium bovis. Replaces original Rv2306c on other strand. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2555083 | 2555517 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2329|Mb2329
MWAVVGQRFVPGISDALASYTFGAFGVPLWQMVVGSFIGSAPRVFVYTALGASITNLSSPLVYSAIAVWCVTAIIGAFAARRWYRKWRARPRRRCGLAQLTTGSQQRHTSHRTPAGVVMPGSLSEHRRLRQEAPDRIEHHPPIE
Bibliography
No article yet recorded