Gene Rv2317
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable sugar-transport integral membrane protein ABC transporter UspB |
| Comments | Rv2317, (MTC3G12.17c), len: 274 aa. Probable uspB, sugar-transport integral membrane protein ABC transporter (see citation below), most similar to Q9CBN7|USPE|ML1769 sugar transport integral membrane protein from Mycobacterium leprae (274 aa), FASTA scores: opt: 1522, E(): 3.4e-89, (85.0% identity in 274 aa overlap); and similar to O32941|ML1425|MLCB2052.29 probable ABC-transport protein, inner membrane component from Mycobacterium leprae (283 aa), FASTA scores: opt: 630, E(): 8.4e-33, (36.55% identity in 268 aa overlap). Also similar to other integral membrane proteins e.g. P73854|LACG|SLR1723 lactose transport system permease protein from Synechocystis sp. strain PCC 6803 (270 aa), FASTA scores: opt: 605, E(): 3.1e-31, (36.0% identity in 264 aa overlap); Q9F3B8|SC5F1.11 putative sugar transport integral membrane protein from Streptomyces coelicolor (307 aa), FASTA scores: opt: 582, E(): 9.7e-30, (34.45% identity in 264 aa overlap); etc. Also similar to O53483|Rv2039c|MTV018.26c sugar transport protein from Mycobacterium tuberculosis (280 aa), FASTA scores: opt: 630, E(): 8.3e-89, (37.7% identity in 268 aa overlap). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2589697 | 2590521 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2317|uspB
MSSPSRVSNTAVYAVLTIGAVITLSPFLLGLLTSFTSAHQFATGTPLQLPRPPTLANYADIADAGFRRAAVVTALMTAVILLGQLTFSVLAAYAFARLQFRGRDALFWVYVATLMVPGTVTVVPLYLMMAQLGLRNTFWALVLPFMFGSPYAIFLLREHFRLIPDDLINAARLDGANTLDVIVHVVIPSSRPVLAALAMITVVSQWNNFMWPLVITSGHKWRVLTVATADLQSRFNDQWTLVMAATTVAIVPLIALFVTFQRHIVASIVVSGLK
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
