Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in cysteine biosynthesis [catalytic activity: acetyl-CoA + L-serine = CoA + O-acetyl-L-serine].
ProductProbable serine acetyltransferase CysE (sat)
CommentsRv2335, (MTCY98.04), len: 229 aa. Probable cysE, serine acetyltransferase, equivalent to O32979|CYSE|ML0838 serine acetyltransferase from Mycobacterium leprae (227 aa), FASTA scores: opt: 1152, E(): 9.6e-62, (76.4% identity in 229 aa overlap). Also highly similar, except in C-terminal part, to others e.g. Q9HXI6|CYSE|PA3816 O-acetylserine synthase from Pseudomonas aeruginosa (258 aa), FASTA scores: opt: 737, E(): 6e-37, (61.3% identity in 168 aa overlap); P23145|NIFP_AZOCH probable serine acetyltransferase from Azotobacter chroococcum mcd 1 (269 aa), FASTA scores: opt: 718, E(): 8.4e-36, (55.45% identity in 220 aa overlap); Q06750|CYSE_BACSU serine acetyltransferase from Bacillus subtilis (217 aa), FASTA scores: opt: 640, E(): 3.1e-31, (48.0% identity in 200 aa overlap); etc. Contains PS00101 Bacterial hexapeptide-repeat containing-transferases signature. Belongs to the CYSE/LACA/LPXA/NODL family of acetyltransferases. Composed of multiple repeats of [LIV]-G-X(4).
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26097322610421+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2335|cysE
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFDWRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI