Gene Rv2335
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in cysteine biosynthesis [catalytic activity: acetyl-CoA + L-serine = CoA + O-acetyl-L-serine]. |
| Product | Probable serine acetyltransferase CysE (sat) |
| Comments | Rv2335, (MTCY98.04), len: 229 aa. Probable cysE, serine acetyltransferase, equivalent to O32979|CYSE|ML0838 serine acetyltransferase from Mycobacterium leprae (227 aa), FASTA scores: opt: 1152, E(): 9.6e-62, (76.4% identity in 229 aa overlap). Also highly similar, except in C-terminal part, to others e.g. Q9HXI6|CYSE|PA3816 O-acetylserine synthase from Pseudomonas aeruginosa (258 aa), FASTA scores: opt: 737, E(): 6e-37, (61.3% identity in 168 aa overlap); P23145|NIFP_AZOCH probable serine acetyltransferase from Azotobacter chroococcum mcd 1 (269 aa), FASTA scores: opt: 718, E(): 8.4e-36, (55.45% identity in 220 aa overlap); Q06750|CYSE_BACSU serine acetyltransferase from Bacillus subtilis (217 aa), FASTA scores: opt: 640, E(): 3.1e-31, (48.0% identity in 200 aa overlap); etc. Contains PS00101 Bacterial hexapeptide-repeat containing-transferases signature. Belongs to the CYSE/LACA/LPXA/NODL family of acetyltransferases. Composed of multiple repeats of [LIV]-G-X(4). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Slow growth mutant by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2609732 | 2610421 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2335|cysE
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFDWRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sassetti CM and Rubin EJ [2003]. Genetic requirements for mycobacterial survival during infection. Mutant
- Schnell R et al. [2007]. Structural insights into catalysis and inhibition of O-acetylserine sulfhydrylase from Mycobacterium tuberculosis. Crystal structures of the enzyme alpha-aminoacrylate intermediate and an enzyme-inhibitor complex. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant