Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPE-PGRS family protein PE_PGRS39
CommentsRv2340c, (MTCY98.09c), len: 413 aa. PE_PGRS39, Member of the Mycobacterium tuberculosis PE_family, PGRS subfamily of gly-rich proteins (see citations below), similar to others eg YI18_MYCTU|Q50615|Rv1818c|MTCY1A11.25 PE-PGRS family protein from Mycobacterium tuberculosis (498 aa), FASTA scores: opt: 710, E(): 1.4e-22, (41.0% identity in 368 aa overlap); O53884|Rv0872v|MTV043.65c PGRS-family protein from Mycobacterium tuberculosis (606 aa), FASTA scores: opt: 708, E(): 1.9e-22, (42.4% identity in 389 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryPe/ppe
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26176672618908-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2340c|PE_PGRS39
MSHVTAAPNVLAASAGELAAIGSTMRAANAAAAAPTAGVLAAGGDDVSAGIAALFGARAQAYQAISAQAALFHDRFVQILQEGAAAYAMAEAANALPLQKAQGVVSELAQDRTGGTGTGQSRGAGGFGGVGQAGGKGWDGGPIGNGQVGEQHGAGQLGSTDGNPGVAGAAHGSGVSASHGSGATGAAGVADPGGSGAGVGSAAGNGTGAGSADAVGGAGTGRDIVGSVRGDGGVGMASGDGGLSTGAAGASAEGGLMPGFGGAPWVGGHWGLGGEGHSGAIGGVGEQVAPAVATAPAVSPATTSAVAAESGSTPATKAQAMHATTNPGNAAHQGNPADPGNSARRADGGRDEQLLLLPLTSLRGLRHTLKKLSGLRARNGLLTASGDNASGSGRPWDRDQLLRALGLRPPGHE