Gene Rv2340c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family protein PE_PGRS39 |
| Comments | Rv2340c, (MTCY98.09c), len: 413 aa. PE_PGRS39, Member of the Mycobacterium tuberculosis PE_family, PGRS subfamily of gly-rich proteins (see citations below), similar to others eg YI18_MYCTU|Q50615|Rv1818c|MTCY1A11.25 PE-PGRS family protein from Mycobacterium tuberculosis (498 aa), FASTA scores: opt: 710, E(): 1.4e-22, (41.0% identity in 368 aa overlap); O53884|Rv0872v|MTV043.65c PGRS-family protein from Mycobacterium tuberculosis (606 aa), FASTA scores: opt: 708, E(): 1.9e-22, (42.4% identity in 389 aa overlap); etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Pe/ppe |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2617667 | 2618908 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2340c|PE_PGRS39
MSHVTAAPNVLAASAGELAAIGSTMRAANAAAAAPTAGVLAAGGDDVSAGIAALFGARAQAYQAISAQAALFHDRFVQILQEGAAAYAMAEAANALPLQKAQGVVSELAQDRTGGTGTGQSRGAGGFGGVGQAGGKGWDGGPIGNGQVGEQHGAGQLGSTDGNPGVAGAAHGSGVSASHGSGATGAAGVADPGGSGAGVGSAAGNGTGAGSADAVGGAGTGRDIVGSVRGDGGVGMASGDGGLSTGAAGASAEGGLMPGFGGAPWVGGHWGLGGEGHSGAIGGVGEQVAPAVATAPAVSPATTSAVAAESGSTPATKAQAMHATTNPGNAAHQGNPADPGNSARRADGGRDEQLLLLPLTSLRGLRHTLKKLSGLRARNGLLTASGDNASGSGRPWDRDQLLRALGLRPPGHE
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant