Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE39
CommentsRv2353c, (MTCY98.22c), len: 354 aa. PPE39, Member of Mycobacterium tuberculosis PPE family, highly similar to many e.g. near ORF P95249|Rv2356c|MTCY98.25 from Mycobacterium tuberculosis (615 aa), FASTA scores: opt: 1566, E(): 3.2e-69, (66.1% identity in 349 aa overlap); Q10778|MTCY48.17, Q10540|MTCY31.06c, E241779|MTCY98, Q10813|MTCY274.23c, P71868|MTCY03C7.23, P71869|MTCY03C7.24c, P42611|MTV037.06C, E64997|MTCY98, Q10707|MTCY49.38C, P71657|MTCY02B10.25c, etc. Note that the ATG and RBS appear to be provided by the IR of neighbouring IS6110. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS26345282635592-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2353c|PPE39
MPGRFRNFGSQNLGSGNIGSTNVGSGNIGSTNVGSGNIGDTNFGNGNNGNFNFGSGNTGSNNIGFGNTGSGNFGFGNTGNNNIGIGLTGDGQIGIGGLNSGSGNIGFGNSGTGNVGLFNSGTGNVGFGNSGTANTGFGNAGNVNTGFWNGGSTNTGLANAGAGNTGFFDAGNYNFGSLNAGNINSSFGNSGDGNSGFLNAGDVNSGVGNAGDVNTGLGNSGNINTGGFNPGTLNTGFFSAMTQAGPNSGFFNAGTGNSGFGHNDPAGSGNSGIQNSGFGNSGYVNTSTTSMFGGNSGVLNTGYGNSGFYNAAVNNTGIFVTGVMSSGFFNFGTGNSGLLVSGNGLSGFFKNLFG