Gene Rv2365c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2365c, (MTCY27.15), len: 113 aa. Conserved hypothetical protein, highly similar to Q49767|ML0630|B1937_F3_101|CAC30138 Hypothetical protein from Mycobacterium leprae (108 aa), FASTA scores: opt: 426, E(): 1.4e-18, (67.9% identity in 106 aa overlap). Also highly similar to Q9RDF3|SCC77.05 from Streptomyces coelicolor (132 aa), FASTA scores: opt: 254, E(): 1.9e-18, (53.1% identity in 96 aa overlap). Equivalent to AAK46728 from Mycobacterium tuberculosis strain CDC1551 (93 aa) but longer 20 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2646747 | 2647088 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2365c|Rv2365c
MMRRPITLAEQLDAEDAKLVVLARAAMARAEAGAGAAVRDVDGRTYAAAPVALSALELTGLQAAVAAAVSSGATGLQAAVLVAGSVDDPGIAAVRELAPTAAIIVTDRAGNPL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
