Gene Rv2368c (phoH)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable PHOH-like protein PhoH1 (phosphate starvation-inducible protein PSIH) |
| Comments | Rv2368c, (MTCY27.12), len: 352 aa. Probable phoH1, phoH-like protein (phosphate starvation-induced protein), probably ATP-binding protein, equivalent to Q49751|PHOL_MYCLE| ML0627|B1937_F1_20 PHOH-like protein from Mycobacterium leprae (349 aa), FASTA scores: opt: 1952, E(): 4.7e-107, (88.9% identity in 352 aa overlap). Also highly similar to Q9L2L5|SCC117.05 PHOH-like protein from Streptomyces coelicolor (359 aa), FASTA scores: opt: 1407, E(): 3.6e-75, (63.6% identity in 349 aa overlap); Q9RSY1|DR1988 PHOH-related protein from Deinococcus radiodurans (380 aa), FASTA scores: opt: 1053, E(): 1.9e-54, (53.3% identity in 349 aa overlap); Q9KD58|PHOH|BH1361 phosphate starvation-induced protein from Bacillus halodurans (320 aa), FASTA scores: opt: 1019, E(): 1.6e-52, (54.35% identity in 300 aa overlap); P46343|PHOL_BACSU PHOH-like protein from Bacillus subtilis (319 aa), FASTA scores: opt: 1014, E(): 3.2e-52, (50.8% identity in 303 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the PHOH family. Note that previously known as phoH. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2648916 | 2649974 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2368c|phoH1
VTSRETRAADAAGARQADAQVRSSIDVPPDLVVGLLGSADENLRALERTLSADLHVRGNAVTLCGEPADVALAERVISELIAIVASGQSLTPEVVRHSVAMLVGTGNESPAEVLTLDILSRRGKTIRPKTLNQKRYVDAIDANTIVFGIGPAGTGKTYLAMAKAVHALQTKQVTRIILTRPAVEAGERLGFLPGTLSEKIDPYLRPLYDALYDMMDPELIPKLMSAGVIEVAPLAYMRGRTLNDAFIVLDEAQNTTAEQMKMFLTRLGFGSKVVVTGDVTQIDLPGGARSGLRAAVDILEDIDDIHIAELTSVDVVRHRLVSEIVDAYARYEEPGSGLNRAARRASGARGRR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
