Gene Rv2371
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE-PGRS family protein PE_PGRS40 |
| Comments | Rv2371, (MTCY27.09c), len: 61 aa. PE_PGRS40, Short protein, member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins (see citation below), highly similar to N-terminal part of others e.g. AAK44356|MT0132 PE_PGRS family protein from Mycobacterium tuberculosis strain CDC1551 (561 aa), FASTA scores: opt: 217, E(): 4.9e-08, (69.65% identity in 56 aa overlap); etc. |
| Functional category | Pe/ppe |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2651753 | 2651938 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2371|PE_PGRS40
MSLVSVAPELVVTAVPDVARIGSSIGAPDTAAAARPTTSVLAAGADEVSADVVALFGWVAR
Bibliography
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant