Gene Mb2392
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | pe-pgrs family protein pe_pgrs40 |
| Comments | Mb2392, PE_PGRS40, len: 61 aa. Equivalent to Rv2371, len: 61 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 61 aa overlap). Short protein,member of the Mycobacterium tuberculosis PE family, PGRS subfamily of gly-rich proteins, highly similar to N-terminal part of others e.g. AAK44356|MT0132 PE_PGRS FAMILY PROTEIN from Mycobacterium tuberculosis strain CDC1551 (561 aa), FASTA scores: opt: 217, E( ): 4.9e-08,(69.65% identity in 56 aa overlap); etc. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2619824 | 2620009 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2392|PE_PGRS40
MSLVSVAPELVVTAVPDVARIGSSIGAPDTAAAARPTTSVLAAGADEVSADVVALFGWVAR
Bibliography
No article yet recorded