Gene Rv2377c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in the biogenesis of the hydroxyphenyloxazoline-containing siderophore mycobactins. |
| Product | Putative conserved protein MbtH |
| Comments | Rv2377c, (MT2445.1, MTCY27.03), len: 71 aa. Putative mbtH, conserved protein with no function assigned (see Quadri et al., 1998; De Voss et al., 1999), similar to hypothetical proteins or proteins found in several gene clusters for biosynthesis or transport of siderophores and other nonribosomally synthesized peptides e.g. Q9Z388|SCE8.11c putative small conserved hypothetical protein from Streptomyces coelicolor (71 aa), FASTA scores: opt: 345, E(): 1.4e-19, (68.2% identity in 66 aa overlap); Q9F8V3|CUMB COUY protein (probably involved in the biosynthesis of aminocoumarin antibiotic coumermycin a(1)) (see Wang et al., 2000) from Streptomyces rishiriensis (71 aa), FASTA scores: opt: 329, E(): 2.2e-18, (63.2% identity in 68 aa overlap); Q9F5J2|SIM-CB MBTH-like protein (probably protein involved in the biosynthesis of aminocoumarin antibiotic coumermycin a(1)) from Streptomyces antibioticus (70 aa), FASTA scores: opt: 308, E(): 8.4e-17, (65.6% identity in 64 aa overlap); Q9FB14 MBTH-like protein (involved in the biosynthesis of the antitumor drug bleomycin) (see Du et al., 2000) from Streptomyces verticillus FASTA scores: opt: 220, E(): 8.8e-10, (41.2% identity in 68 aa overlap); etc. |
| Functional category | Lipid metabolism |
| Transcriptomics | DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2656215 | 2656430 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2377c|mbtH
VSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMVED
Bibliography
- Quadri LE et al. [1998]. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Secondary Function
- De Voss JJ et al. [1999]. Iron acquisition and metabolism by mycobacteria. Review
- Wang ZX et al. [2000]. Identification of the coumermycin A(1) biosynthetic gene cluster of Streptomyces rishiriensis DSM 40489. Secondary Function
- Du L et al. [2000]. The biosynthetic gene cluster for the antitumor drug bleomycin from Streptomyces verticillus ATCC15003 supporting functional interactions between nonribosomal peptide synthetases and a polyketide synthase. Secondary Function
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Transcriptome
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
