Gene Mb2398c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PUTATIVE CONSERVED PROTEIN MBTH |
| Comments | Mb2398c, mbtH, len: 71 aa. Equivalent to Rv2377c,len: 71 aa, from Mycobacterium tuberculosis strain H37Rv,(98.6% identity in 71 aa overlap). Putative mbtH,conserved protein with no function assigned (see first and second citation), similar to hypothetical proteins or proteins found in several gene clusters for biosynthesis or transport of siderophores and other nonribosomally synthesized peptides e.g. Q9Z388|SCE8.11c PUTATIVE SMALL CONSERVED HYPOTHETICAL PROTEIN from Streptomyces coelicolor (71 aa), FASTA scores: opt: 345, E(): 1.4e-19,(68.2% identity in 66 aa overlap); Q9F8V3|CUMB COUY PROTEIN (probably involved in the biosynthesis of aminocoumarin antibiotic coumermycin A(1)) (see third citation below) from Streptomyces rishiriensis (71 aa),FASTA scores: opt: 329, E(): 2.2e-18, (63.2% identity in 68 aa overlap); Q9F5J2|SIM-CB MBTH-LIKE PROTEIN (probably protein involved in the biosynthesis of aminocoumarin antibiotic coumermycin A(1)) from Streptomyces antibioticus (70 aa), FASTA scores: opt: 308, E(): 8.4e-17, (65.6% identity in 64 aa overlap); Q9FB14 MBTH-LIKE PROTEIN (involved in the biosynthesis of the antitumor drug bleomycin) (see fourth citation below) from Streptomyces verticillus FASTA scores: opt: 220, E(): 8.8e-10, (41.2% identity in 68 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2624286 | 2624501 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb2398c|mbtH
MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLRPKSLRDAMAED
Bibliography
No article yet recorded