Gene Rv2418c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Transfers octanoate to glucosylglycerate (GG) and diglucosylglycerate (DGG), the earliest intermediates in methylglucose lipopolysaccharides (MGLP) biosynthesis (see Maranha et al. 2015). |
Product | Sugar octanoyltransferase OctT |
Comments | Enzymatic studies, synthetic chemistry, NMR spectroscopy and mass spectrometry approaches suggest that, in contrast to the prevailing consensus, octanoate is not esterified to the primary hydroxyl group of glycerate but instead to the C6 OH of the second glucose in DGG (see Maranha et al. 2015). |
Functional category | Conserved hypotheticals |
Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
Mutant | Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2716395 | 2717138 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2418c|octT MSSRRGRRPALLVFADSLAYYGPTGGLPADDPRIWPNIVASQLDWDLELIGRIGWTCRDVWWAATQDPRAWAALPRAGAVIFATGGMDSLPSVLPTALRELIRYVRPSWLRRWVRDGYAWVQPRLSPVARAALPPHLTAEYLEKTRGAIDFNRPGIPIIASLPSVHIAETYGKAHHGRAGTVAAITEWAQHHDIPLVDLKAAVAEQILSGYGNRDGIHWNFEAHQAVAELMLKALAEAGVPNEKSRG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- Maranha A et al. [2015]. Octanoylation of early intermediates of mycobacterial methylglucose lipopolysaccharides. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant