Gene Rv2421c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in NAD biosynthesis; catalyzes the reversible adenylation of nicotinate mononucleotide [catalytic activity: ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD(+)]. |
| Product | Probable nicotinate-nucleotide adenylyltransferase NadD (deamido-NAD(+) pyrophosphorylase) (deamido-NAD(+) diphosphorylase) (nicotinate mononucleotide adenylyltransferase) (NAMN adenylyltransferase) |
| Comments | Rv2421c, (MT2494, MTCY428.26), len: 211 aa. Probable nadD, nicotinate-nucleotide adenylyltransferase , equivalent to Q9CBZ8|NADD_MYCLE|ML1454 probable nicotinate-nucleotide adenylyltransferase from Mycobacterium leprae (214 aa), FASTA scores: opt: 1125, E(): 2.7e-66, (80.2% identity in 212 aa overlap). Also highly similar to Q9RDK7|NADD_STRCO probable nicotinate-nucleotide adenylyltransferase from Streptomyces coelicolor (188 aa), FASTA scores: opt: 855, E(): 9.8e-49, (66.5% identity in 194 aa overlap); and similar to others e.g. P54455|NADD_BACSU from Bacillus subtilis (189 aa), FASTA scores: opt: 351, E(): 7e-16, (36.1% identity in 191 aa overlap); etc. Belongs to the NadD family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2718173 | 2718808 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2421c|nadD
MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLYCGACDAGARSTTSLAAGNGL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
