Gene Rv2424c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Required for the transposition of the insertion element IS1558. |
| Product | Probable transposase |
| Comments | Rv2424c, (MTCY428.23), len: 333 aa. Probable transposase for IS1558, similar to is element proteins e.g. AL021957|Rv2177c|MTV021_10 from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 1491, E(): 6.2e-87, (98.6% identity in 221 aa overlap); P19780|YIS1_STRCO hypothetical insertion element IS110 from Streptomyces coelicolor (45 aa), FASTA scores: opt: 203, E(): 1.7e-05; (27.3% identity in 238 aa overlap); etc. Contains PS01159 WW/rsp5/WWP domain signature. |
| Functional category | Insertion seqs and phages |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2720776 | 2721777 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2424c|Rv2424c
VQCRAREERPGRKTDLLDAEWLVHLLECGLLRGWLIPPADIKAARDVIRYRRKLVEHRTSKLQRLGNVLQDAGIKADSVASSVTPKSVRAMVEALIDGERRPAVLADLARGSMRSKIPDLQRALEGRFDDHHALMCRLHLAHLDQLDAMIGALDEQIEQLMHPFCARRELIASIPGIGVGASATVISEIGADPAAWFPSAEHLASWVRLCPGNHESAGKRHHGARRTGNQHLQPVLVECAWAAVRTDGYLREYYRRQVRKFGGFRSPAANKKAITTVAHKLIVIIWHVLATGRPHQDLGADYFTTRMDPDKERRRLVAKLEAQGLGVTLEPAA
Bibliography
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant